PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00070399001
Common NameGSBRNA2T00070399001, LOC106391041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 220aa    MW: 23219.8 Da    PI: 9.2568
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00070399001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.11.7e-372483362
               zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                          ++l+cprC+stntkfCyynny+ sqPr+fCkaCrryWt+GG+lr++PvGg +rk+ k+s
  GSBRNA2T00070399001 24 PDQLPCPRCESTNTKFCYYNNYNFSQPRHFCKACRRYWTHGGTLRDIPVGGVSRKSSKRS 83
                         56899**************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31275IPR003851Zinc finger, Dof-type
PfamPF027017.0E-332681IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5842781IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102965IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MPSDVNESRR LTKIPHGGAA ADQPDQLPCP RCESTNTKFC YYNNYNFSQP RHFCKACRRY  60
WTHGGTLRDI PVGGVSRKSS KRSRTCSSVP VSTAVGSREF PLQATPVLFP PSSNDGGVTA  120
AKGTASSAFG GFTSLLSYNA AASRNGPGGR FNGLEGFGLG LGQGSYFDNV RFGQGITVWP  180
FSTGATDATS AVTSHVGPIP ATWQFEGPES KVGFVSGDY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.253790.0flower
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00070399001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593880.11e-161PREDICTED: dof zinc finger protein DOF5.8
RefseqXP_013687059.11e-161PREDICTED: dof zinc finger protein DOF5.8-like
SwissprotQ9FGD61e-116DOF58_ARATH; Dof zinc finger protein DOF5.8
TrEMBLA0A078FEI81e-161A0A078FEI8_BRANA; BnaC07g16430D protein
TrEMBLA0A0D3D8A91e-161A0A0D3D8A9_BRAOL; Uncharacterized protein
STRINGBra012119.1-P1e-139(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22862874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.13e-99Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]